Home New Trending Search
About Privacy Terms
#
#SleepDisorders
Posts tagged #SleepDisorders on Bluesky
Post image

Today is #WorldSleepDay — a reminder that sleep is essential for health and well-being.

A landmark 2006 National Academies report examined the widespread impact of #SleepDisorders and #SleepDeprivation and outlined recommendations to advance research: https://ow.ly/1EWP50YtF78

5 2 0 0
Post image Post image

📣 Changing how we understand #sleepiness starts with awareness. When we recognize that sleepiness is a health signal, not a character flaw, we create more support for people navigating sleep challenges and #sleepdisorders.

➡️ Take action this #SleepAwarenessMonth: https://ow.ly/3V4n50YsP86

1 0 0 0

Oh no...
I just realized Daylight "Savings" Time starts this weekend.
My sleep disorders and I hate it with a white-hot passion!
#AbolishDST #sleepdisorders

6 0 1 0

Follow @biohackingpathway for more

#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome

0 0 0 0
Preview
Focus on Traumatic Brain Injury Research Traumatic brain injury (TBI) occurs when external physical forces cause damage to the brain, whether from impact, penetrating objects, blast waves or rapid movement of the brain within the skull.

tinyurl.com/483hv2yt
#TBI also can have long-term sequelae including #cognitive #dysfunction, #pain, #sleepdisorders and physical #disability collectively known as the #postconcussionsyndrome (#PCS)

0 0 0 0
Preview
Modernizing Traumatic Brain Injury Care for Veterans: Why the BEACON Act Matters Bipartisan BEACON Act would modernize VA traumatic brain injury care with evidence-based, veteran-centered treatments.

tinyurl.com/2j2skhx4
For many veterans, #TBI does not exist in isolation. It often intersects with #posttraumaticstress, #sleepdisorders, #depression, #chronicpain.

1 0 0 0
2022 11 01 - CWRU SMGR: Dr. Avram Gold - Why Are OSA Patients Sleepy?
2022 11 01 - CWRU SMGR: Dr. Avram Gold - Why Are OSA Patients Sleepy? YouTube video by Sleep Medicine Grand Rounds

A video about obstructive sleep apnea #OSA by Dr. Gold to watch before our 3/6/26 Clinician's Roundtable with him:

"Sleep Medicine Grand Rounds by Dr. Gold (2022)
Why Are OSA Patients Sleepy?" www.youtube.com/watch?v=7QpI...

#SleepDisorders #SleepMedicine

2 0 1 0

Dr. Avram Gold is a pioneer in researching links between #SleepDisorders, upper airway resistance syndrome #UARS, #MECFS, functional somatic syndromes #FSS

Topics he covers:

FSS, sleep-breathing disorders, central sensitivity syndrome, sleep-disordered breathing, stress, anxiety, depression, MECFS

2 0 1 0
Preview
Low-Dose Opioids Maintain Long-Term Stability in Restless Legs Syndrome Low-dose opioid therapy provides stable, long-term symptom control and dose stability for patients with augmented restless legs syndrome.

New research shows low-dose opioids may control severe RLS symptoms long-term without dose increases. 🔗 Read more: www.neurologyadvisor.com/news/low-dose-opioids-st... #Neurology #RestlessLegsSyndrome #SleepDisorders #MedicalResearch #Healthcare #ChronicConditions

0 0 0 0
Video thumbnail

🎉 TODAY is the day to tackle the sleep issues you’ve been putting off hoping they’d go away. The Sleep Helpline is a free, national resource offering personalized support and information for people facing #sleepissues and #sleepdisorders.

📞 Contact us today: https://ow.ly/v50S50YkOF6

0 0 0 0
Post image Post image

📣 ONE WEEK left to apply for our 2026 Rising Voices training! Rising Voices equips people with #sleepdisorders to raise awareness and reduce stigma through authentic storytelling and public speaking.

➡️ SHARE this post and apply: https://ow.ly/4n8T50YjLoI

0 0 1 0
Post image Post image

📣 Project Sleep is accepting applications for the 2026 Rising Voices online training, taking place May 1–June 5, 2026. This program equips people living with #sleepdisorders to raise awareness and reduce stigma through storytelling and public speaking.

⏳ Apply by March 1: https://ow.ly/MBQe50YeFy4

0 0 0 0
Preview
Sleep Disorders in Children | Sleep Foundation Sleep is vital for kids, yet many have sleep issues. We cover common sleep disorders in children, the unique causes, and tips to help your child sleep better.

"Certain sleep disorders have similar causes in both adults and children. Obesity is a leading risk factor for developing obstructive sleep apnea."

#SleepDisorders #SleepApnea #Children

www.sleepfoundation.org/children-and...

0 0 0 0
Preview
Predictive Modeling of Preoperative Sleep Disorder Risk in Older Adults by Using Data From Wearable Monitoring Devices: Prospective Cohort Study Background: Sleep disorders are common among older adults undergoing surgery and contribute significantly to postoperative complications, delayed recovery, and higher health care costs. The combined effects of age-related physiological changes and surgical stress further disrupt sleep in this vulnerable group. However, current tools for predicting surgical risk rarely account for the specific physiological, clinical, and psychological factors that affect older patients. While wearable devices are used to monitor sleep, most prediction models focus on general sleep quality in nonsurgical populations, leaving a gap in forecasting preoperative sleep disorders in older surgical candidates. Therefore, we developed and validated a tailored risk prediction model that integrates objective sleep data from wearable devices with comprehensive clinical and psychosocial evaluations for older adults preparing for surgery. Objective: We aimed to develop and validate a risk prediction model for preoperative sleep disorders in older adult surgical patients by using data from smart wearable devices and clinical assessments, thereby facilitating early identification of the influencing factors and providing a scientific basis for personalized care planning. Methods: We conducted a prospective study at the Second Affiliated Hospital of Zunyi Medical University. A cohort of 242 older surgical patients was monitored using smart rings on the night before surgery. We simultaneously collected data on sociodemographic factors, cognition, and psychological status. As per preoperative sleep assessments, patients were classified into sleep disorder and non–sleep disorder groups. Independent predictors of sleep disorders were identified using univariable and multivariable logistic regression. These predictors were used to build a risk prediction model, which was internally validated with 1000 bootstrap samples. The model’s performance was evaluated by its ability to discriminate between groups (using receiver operating characteristic curves), its calibration, and its clinical usefulness (via decision curve analysis). Results: Multifactorial logistic regression analysis showed that Hospital Anxiety and Depression Scale score (odds ratio [OR] 3.21, 95% CI 1.54-6.69; P=.002), number of awakenings (OR 3.33, 95% CI 1.82-6.12; P

JMIR Formative Res: Predictive Modeling of Preoperative Sleep Disorder Risk in Older Adults by Using Data From Wearable Monitoring Devices: Prospective Cohort Study #SleepDisorders #WearableTechnology #Healthcare #OlderAdults #Surgery

0 0 0 0
Video thumbnail

👂Your body might be trying to tell you something. #SleepDisorders affect 1 in 5 Americans, yet so many people go undiagnosed because symptoms get brushed off, misread, or blamed on stress and a busy life.

➡️ Download our Talking to Your Doctor About Sleep Issues toolkit: https://ow.ly/lp4n50YbkO3

0 0 0 0

Thank you for your helpful insight Matthias! I found this article & it really illuminated some things for me. I thought maybe someone else might find it useful, as well! #CPTSD #PTSD #sleepdisorders

www.ptsduk.org/sleep-and-co...

3 0 0 0
Orexin Receptor Antagonist Market Growth Outlook 2035 Orexin Receptor Antagonist Market growth is projected to reach 15.47 billion, at a 15.71% CAGR by driving industry size, share, top company analysis, segments research, trends and forecast report 2025...

Demand for advanced sleep disorder treatments is boosting the Orexin Receptor Antagonist Market. Learn more: www.marketresearchfuture.com/reports/orex...
#SleepDisorders #CNSDrugs #Pharma

0 0 0 0
Post image Post image

🎉 The next generation of sleep advocates is here! Applications are NOW OPEN for Project Sleep's Rising Voices online summer training. The program trains people with #sleepdisorders to raise awareness and reduce stigma through public speaking.

➡️ Apply by March 1, 2026: https://ow.ly/V8Sr50Y6vtm

1 1 0 0
Video thumbnail

No. 1 #BJGPTop10 Insomnia: Effectiveness of amitriptyline and mirtazapine for insomnia doi.org/10.3399/BJGP...

@apexcomms.bsky.social @cancerresearchuk.org

#Insomnia #SleepDisorders #RCT #SleepHealth #MentalHealth #SleepWell #PrimaryCare #BJGP #research

0 0 0 0
Video thumbnail

No. 1 #BJGPTop10 Insomnia: Effectiveness of amitriptyline and mirtazapine for insomnia doi.org/10.3399/BJGP...

@n-akter.bsky.social @manchester.ac.uk @mcrcnews.bsky.social @liverpooluni.bsky.social @cccnhs.bsky.social

#Insomnia #SleepDisorders #RCT #MentalHealth #PrimaryCare #BJGP #research

0 0 1 0
Video thumbnail

No. 1 #BJGPTop10 Insomnia: Effectiveness of amitriptyline and mirtazapine for insomnia doi.org/10.3399/BJGP...
@exeter.ac.uk @y-lyratzopoulos.bsky.social @sammerriel.bsky.social @fbmh-uom.bsky.social @ruthswann.bsky.social

#Insomnia #SleepDisorders #RCT #MentalHealth #PrimaryCare #BJGP #research

1 1 1 0

Follow @biohackingpathway for more

#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome

0 0 0 0
Preview
Sleep disorders in children: classification, evaluation, and management. A review Sleep disorders are prevalent in children and adolescents and can have profound effects on mental, social, and physical development. Learn how to identify the signs earlier and provide effective…

#SleepDisorders can have a profound effect on development in children and adolescents. Learn how to identify the signs earlier and provide effective treatment.

👉 buff.ly/R4Xirt8

#SleepMed #Somnology

0 0 1 0
Post image

Elucidating the integrated network of #CircadianRhythms, #SleepDisorders, and #MitochondrialDysfunction in #ParkinsonsDisease, highlighting how SCN-nigrostriatal and gut-brain oscillations drive #Neurodegeneration.

#OpenAccess: doi.org/10.1016/j.ge...

0 0 0 0
Post image

🤔 Always tired and not sure why? Project Sleep’s Sleep Helpline™ is a free, national resource offering personalized support and information for people facing #sleepissues and #sleepdisorders.

💯 You don't have to figure it out on your own. Contact the Sleep Helpline today: https://ow.ly/MWXh50XUcjF

0 0 0 0
Post image

One peptide system coordinates stress, vigilance, and behavior !🧠⚡🧬😮 Orexin integrates autonomic, endocrine, and learning circuits across species! @mdpiopenaccess.bsky.social
#Neuroscience #OrexinSystem #StressAdaptation #SleepDisorders #Anxiety
Read & rethink vigilance → doi.org/10.3390/biom...

1 1 0 0

Suspecting that I may have a circadian rhythm sleep disorder.

Anyone any good resources for these circadian rhythm problems?

Links or personal experience.

Please repost to reach more.

#SleepDisorders #CircadianRhythmSleepDisorder

0 1 1 0
Post image

Surprising truth: Your brain’s “alert mode” is chemically controlled! 🤯🧠🌙⚡😊
Orexin helps explain stress, fear, learning, and why sleep matters so much! @mdpiopenaccess.bsky.social #Neuroscience #BrainChemistry #StressResponse #SleepDisorders #Anxiety
Explore the science → doi.org/10.3390/biom...

1 1 0 0
Video thumbnail

You Ever Suffered From This?

"There is a DEMON in My Room | Betsy Allen" Out Now #Youtube #Apple #Spotify

#SleepParalysis #Creepalachia #SleepHealth #MentalHealth #NightTerrors #SleepScience #HealthEducation #UnexplainedFeelings #SleepDisorders #UnderstandingSleep

1 1 0 0

Sleep calls ever, never stilled
A monster's hunger, an addict's thrill
Abstaining makes all life a dream
But sleep too deep, and miss sun-beams
Find a balance of a gentler kind
In this, preserve your peace of mind

#idiopathichypersomnia #ih #poetry #sleep #sleepdisorders

2 0 0 0